Lineage for d1kh3a2 (1kh3 A:171-395)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563173Fold d.210: Argininosuccinate synthetase, C-terminal domain [69863] (1 superfamily)
    unusual fold
  4. 2563174Superfamily d.210.1: Argininosuccinate synthetase, C-terminal domain [69864] (2 families) (S)
  5. 2563175Family d.210.1.1: Argininosuccinate synthetase, C-terminal domain [69865] (2 protein domains)
  6. 2563176Protein Argininosuccinate synthetase, C-terminal domain [69866] (3 species)
  7. 2563187Species Thermus thermophilus [TaxId:274] [75594] (7 PDB entries)
  8. 2563200Domain d1kh3a2: 1kh3 A:171-395 [84393]
    Other proteins in same PDB: d1kh3a1, d1kh3b1, d1kh3c1, d1kh3d1
    complexed with anp, arg, mg, so4

Details for d1kh3a2

PDB Entry: 1kh3 (more details), 2.15 Å

PDB Description: Crystal Structure of Thermus thermophilus HB8 Argininosuccinate Synthetase in complex with inhibitor
PDB Compounds: (A:) Argininosuccinate Synthetase

SCOPe Domain Sequences for d1kh3a2:

Sequence, based on SEQRES records: (download)

>d1kh3a2 d.210.1.1 (A:171-395) Argininosuccinate synthetase, C-terminal domain {Thermus thermophilus [TaxId: 274]}
pysmdanllhisyeggvledpwaeppkgmfrmtqdpeeapdapeyveveffegdpvavng
erlspaallqrlneiggrhgvgrvdivenrfvgmksrgvyetpggtilyharravesltl
drevlhqrdmlspkyaelvyygfwyaperealqayfdhvarsvtgvarlklykgnvyvvg
rkapkslyrqdlvsfdeaggydqkdaegfikiqalrlrvralver

Sequence, based on observed residues (ATOM records): (download)

>d1kh3a2 d.210.1.1 (A:171-395) Argininosuccinate synthetase, C-terminal domain {Thermus thermophilus [TaxId: 274]}
pysmdanllhisyeggvledpwaeppkgmfrmtqdpeeapdapeyveveffegdpvavng
erlspaallqrlneiggrhgvgrvdivenrfvgmksrgvyetpggtilyharravesltl
drevlhqrdmlspkyaelvyygfwyaperealqayfdhvarsvtgvarlklykgnvyvvg
rkapkslyrgydqkdaegfikiqalrlrvralver

SCOPe Domain Coordinates for d1kh3a2:

Click to download the PDB-style file with coordinates for d1kh3a2.
(The format of our PDB-style files is described here.)

Timeline for d1kh3a2: