Lineage for d1kfgb2 (1kfg B:457-614)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 552572Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 552586Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families) (S)
  5. 552600Family b.2.2.2: Cellulose-binding domain family III [49390] (4 proteins)
    Pfam 00963
  6. 552618Protein Endo/exocellulase:cellobiose E-4, C-terminal domain [49394] (2 species)
  7. 552619Species Clostridium cellulolyticum, atcc 35319 [TaxId:1521] [89209] (4 PDB entries)
    endoglucanase 9G
  8. 552627Domain d1kfgb2: 1kfg B:457-614 [84390]
    Other proteins in same PDB: d1kfga1, d1kfgb1
    complexed with ca, cry, glc, gs1, gs4, mg, ni, trs

Details for d1kfgb2

PDB Entry: 1kfg (more details), 1.9 Å

PDB Description: the x-ray crystal structure of cel9g from clostridium cellulolyticum complexed with a thio-oligosaccharide inhibitor

SCOP Domain Sequences for d1kfgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfgb2 b.2.2.2 (B:457-614) Endo/exocellulase:cellobiose E-4, C-terminal domain {Clostridium cellulolyticum, atcc 35319}
deviikaglnstgpnyteikavvynqtgwparvtdkisfkyfmdlseivaagidplslvt
ssnysegkntkvsgvlpwdvsnnvyyvnvdltgeniypggqsacrrevqfriaapqgtty
wnpkndfsydglpttstvntvtnipvydngvkvfgnep

SCOP Domain Coordinates for d1kfgb2:

Click to download the PDB-style file with coordinates for d1kfgb2.
(The format of our PDB-style files is described here.)

Timeline for d1kfgb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kfgb1