![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families) ![]() |
![]() | Family b.2.2.2: Cellulose-binding domain family III [49390] (4 proteins) Pfam 00963 |
![]() | Protein Endo/exocellulase:cellobiose E-4, C-terminal domain [49394] (2 species) |
![]() | Species Clostridium cellulolyticum, atcc 35319 [TaxId:1521] [89209] (4 PDB entries) endoglucanase 9G |
![]() | Domain d1kfgb2: 1kfg B:457-614 [84390] Other proteins in same PDB: d1kfga1, d1kfgb1 |
PDB Entry: 1kfg (more details), 1.9 Å
SCOP Domain Sequences for d1kfgb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kfgb2 b.2.2.2 (B:457-614) Endo/exocellulase:cellobiose E-4, C-terminal domain {Clostridium cellulolyticum, atcc 35319} deviikaglnstgpnyteikavvynqtgwparvtdkisfkyfmdlseivaagidplslvt ssnysegkntkvsgvlpwdvsnnvyyvnvdltgeniypggqsacrrevqfriaapqgtty wnpkndfsydglpttstvntvtnipvydngvkvfgnep
Timeline for d1kfgb2: