Lineage for d1kfgb1 (1kfg B:2-456)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 920404Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 920405Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 920422Family a.102.1.2: Cellulases catalytic domain [48213] (11 proteins)
  6. 920455Protein Endo/exocellulase:cellobiose E-4, N-terminal domain [48216] (2 species)
  7. 920456Species Clostridium cellulolyticum, atcc 35319 [TaxId:1521] [89107] (4 PDB entries)
    endoglucanase 9G
  8. 920464Domain d1kfgb1: 1kfg B:2-456 [84389]
    Other proteins in same PDB: d1kfga2, d1kfgb2
    complexed with ca, gol, mg, ni, trs

Details for d1kfgb1

PDB Entry: 1kfg (more details), 1.9 Å

PDB Description: the x-ray crystal structure of cel9g from clostridium cellulolyticum complexed with a thio-oligosaccharide inhibitor
PDB Compounds: (B:) endoglucanase g

SCOPe Domain Sequences for d1kfgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfgb1 a.102.1.2 (B:2-456) Endo/exocellulase:cellobiose E-4, N-terminal domain {Clostridium cellulolyticum, atcc 35319 [TaxId: 1521]}
gtynygealqksimfyefqrsgdlpadkrdnwrddsgmkdgsdvgvdltggwydagdhvk
fnlpmsytsamlawslyedkdaydksgqtkyimdgikwandyfikcnptpgvyyyqvgdg
gkdhswwgpaevmqmerpsfkvdaskpgsavcastaaslasaavvfkssdptyaekcish
aknlfdmadkaksdagytaasgyyssssfyddlswaavwlylatndstyldkaesyvpnw
gkeqqtdiiaykwgqcwddvhygaelllakltnkqlykdsiemnldfwttgvngtrvsyt
pkglawlfqwgslrhattqaflagvyaewegctpskvsvykdflksqidyalgstgrsfv
vgygvnppqhphhrtahgswtdqmtsptyhrhtiygalvggpdnadgytdeinnyvnnei
acdynagftgalakmykhsggdpipnfkaiekitn

SCOPe Domain Coordinates for d1kfgb1:

Click to download the PDB-style file with coordinates for d1kfgb1.
(The format of our PDB-style files is described here.)

Timeline for d1kfgb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kfgb2