Lineage for d1kfga1 (1kfg A:3-456)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284239Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array
  4. 284240Superfamily a.102.1: Six-hairpin glycosyltransferases [48208] (6 families) (S)
  5. 284252Family a.102.1.2: Cellulases catalytic domain [48213] (7 proteins)
  6. 284271Protein Endo/exocellulase:cellobiose E-4, N-terminal domain [48216] (2 species)
  7. 284272Species Clostridium cellulolyticum, atcc 35319 [TaxId:1521] [89107] (4 PDB entries)
    endoglucanase 9G
  8. 284279Domain d1kfga1: 1kfg A:3-456 [84387]
    Other proteins in same PDB: d1kfga2, d1kfgb2

Details for d1kfga1

PDB Entry: 1kfg (more details), 1.9 Å

PDB Description: the x-ray crystal structure of cel9g from clostridium cellulolyticum complexed with a thio-oligosaccharide inhibitor

SCOP Domain Sequences for d1kfga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfga1 a.102.1.2 (A:3-456) Endo/exocellulase:cellobiose E-4, N-terminal domain {Clostridium cellulolyticum, atcc 35319}
tynygealqksimfyefqrsgdlpadkrdnwrddsgmkdgsdvgvdltggwydagdhvkf
nlpmsytsamlawslyedkdaydksgqtkyimdgikwandyfikcnptpgvyyyqvgdgg
kdhswwgpaevmqmerpsfkvdaskpgsavcastaaslasaavvfkssdptyaekcisha
knlfdmadkaksdagytaasgyyssssfyddlswaavwlylatndstyldkaesyvpnwg
keqqtdiiaykwgqcwddvhygaelllakltnkqlykdsiemnldfwttgvngtrvsytp
kglawlfqwgslrhattqaflagvyaewegctpskvsvykdflksqidyalgstgrsfvv
gygvnppqhphhrtahgswtdqmtsptyhrhtiygalvggpdnadgytdeinnyvnneia
cdynagftgalakmykhsggdpipnfkaiekitn

SCOP Domain Coordinates for d1kfga1:

Click to download the PDB-style file with coordinates for d1kfga1.
(The format of our PDB-style files is described here.)

Timeline for d1kfga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kfga2