Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [89340] (1 PDB entry) |
Domain d1kdq.1: 1kdq A:,B: [84386] chymotrypsin B complexed with ca; mutant |
PDB Entry: 1kdq (more details), 2.55 Å
SCOPe Domain Sequences for d1kdq.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1kdq.1 b.47.1.2 (A:,B:) (alpha,gamma)-chymotrypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]} vngedaipgswpwqvslqdktgfhfcggslisedwvvtaahcgvktsdvvvagefdqgsd eeniqvlkiaqvfknpkfnmftvrnditllklatpaqfsetvsavslpnvdddfppgtvc attgwgktkyXtpeklqqaalpivseadckkswgskitdvmtcagasgvdscmgdsggpl vcqkdgvwtlagivswgsgvcststpavysrvtalmpwvqqilean
Timeline for d1kdq.1: