Lineage for d1kdq.1 (1kdq A:,B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1793331Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 1793332Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)
  7. 1793421Species Norway rat (Rattus norvegicus) [TaxId:10116] [89340] (1 PDB entry)
  8. 1793422Domain d1kdq.1: 1kdq A:,B: [84386]
    chymotrypsin B
    complexed with ca; mutant

Details for d1kdq.1

PDB Entry: 1kdq (more details), 2.55 Å

PDB Description: crystal structure analysis of the mutant s189d rat chymotrypsin
PDB Compounds: (A:) chymotrypsin b, b chain, (B:) chymotrypsin b, c chain

SCOPe Domain Sequences for d1kdq.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1kdq.1 b.47.1.2 (A:,B:) (alpha,gamma)-chymotrypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vngedaipgswpwqvslqdktgfhfcggslisedwvvtaahcgvktsdvvvagefdqgsd
eeniqvlkiaqvfknpkfnmftvrnditllklatpaqfsetvsavslpnvdddfppgtvc
attgwgktkyXtpeklqqaalpivseadckkswgskitdvmtcagasgvdscmgdsggpl
vcqkdgvwtlagivswgsgvcststpavysrvtalmpwvqqilean

SCOPe Domain Coordinates for d1kdq.1:

Click to download the PDB-style file with coordinates for d1kdq.1.
(The format of our PDB-style files is described here.)

Timeline for d1kdq.1: