Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.9: Barstar-like [52037] (2 superfamilies) 2 layers, a/b; parallel beta-sheet of 3 strands, order 123 |
Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) |
Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein) contains irregular N-terminal extension to the common fold |
Protein Ribosomal protein L32e [52044] (1 species) |
Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries) Uniprot P12736 |
Domain d1kc8z_: 1kc8 Z: [84381] Other proteins in same PDB: d1kc81_, d1kc82_, d1kc83_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8h_, d1kc8i_, d1kc8j_, d1kc8k_, d1kc8l_, d1kc8m_, d1kc8n_, d1kc8o_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_ complexed with bls, cd, cl, k, mg, na |
PDB Entry: 1kc8 (more details), 3.01 Å
SCOPe Domain Sequences for d1kc8z_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kc8z_ c.9.2.1 (Z:) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]} telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr erieeeaedagirvlnptyvev
Timeline for d1kc8z_:
View in 3D Domains from other chains: (mouse over for more information) d1kc81_, d1kc82_, d1kc83_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8h_, d1kc8i_, d1kc8j_, d1kc8k_, d1kc8l_, d1kc8m_, d1kc8n_, d1kc8o_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_ |