Lineage for d1kc8x_ (1kc8 X:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1030518Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
    core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold
  4. 1030519Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) (S)
  5. 1030520Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)
  6. 1030521Protein Archaeal L30 (L30a) [55133] (1 species)
    long-chain member of the family; contains additional C-terminal (sub)domain
  7. 1030522Species Haloarcula marismortui [TaxId:2238] [55134] (40 PDB entries)
    Uniprot P14121
  8. 1030550Domain d1kc8x_: 1kc8 X: [84379]
    Other proteins in same PDB: d1kc81_, d1kc82_, d1kc83_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8h_, d1kc8i_, d1kc8j_, d1kc8k_, d1kc8l_, d1kc8m_, d1kc8n_, d1kc8o_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8y_, d1kc8z_
    complexed with bls, cd, cl, k, mg, na

Details for d1kc8x_

PDB Entry: 1kc8 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Blasticidin S Bound to the 50S Ribosomal Subunit
PDB Compounds: (X:) ribosomal protein l30

SCOPe Domain Sequences for d1kc8x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kc8x_ d.59.1.1 (X:) Archaeal L30 (L30a) {Haloarcula marismortui [TaxId: 2238]}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr

SCOPe Domain Coordinates for d1kc8x_:

Click to download the PDB-style file with coordinates for d1kc8x_.
(The format of our PDB-style files is described here.)

Timeline for d1kc8x_: