Lineage for d1kc8w_ (1kc8 W:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 276870Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 276876Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
  5. 276877Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 276878Protein Ribosomal protein L29 (L29p) [46563] (1 species)
  7. 276879Species Archaeon Haloarcula marismortui [TaxId:2238] [46564] (12 PDB entries)
  8. 276885Domain d1kc8w_: 1kc8 W: [84378]
    Other proteins in same PDB: d1kc81_, d1kc82_, d1kc83_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8h_, d1kc8i_, d1kc8j_, d1kc8k_, d1kc8l_, d1kc8m_, d1kc8n_, d1kc8o_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8x_, d1kc8y_, d1kc8z_
    complexed with bls, cd, cl, k, mg, na

Details for d1kc8w_

PDB Entry: 1kc8 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Blasticidin S Bound to the 50S Ribosomal Subunit

SCOP Domain Sequences for d1kc8w_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kc8w_ a.2.2.1 (W:) Ribosomal protein L29 (L29p) {Archaeon Haloarcula marismortui}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

SCOP Domain Coordinates for d1kc8w_:

Click to download the PDB-style file with coordinates for d1kc8w_.
(The format of our PDB-style files is described here.)

Timeline for d1kc8w_: