Lineage for d1kc8u_ (1kc8 U:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 946782Superfamily b.34.5: Translation proteins SH3-like domain [50104] (7 families) (S)
    many known members contain KOW motif
  5. 946783Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 946826Protein Ribosomal proteins L24 (L24p) [50106] (4 species)
  7. 946866Species Haloarcula marismortui [TaxId:2238] [50107] (44 PDB entries)
    Uniprot P10972
  8. 946894Domain d1kc8u_: 1kc8 U: [84376]
    Other proteins in same PDB: d1kc81_, d1kc82_, d1kc83_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8h_, d1kc8i_, d1kc8j_, d1kc8k_, d1kc8l_, d1kc8m_, d1kc8n_, d1kc8o_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_, d1kc8z_
    complexed with bls, cd, cl, k, mg, na

Details for d1kc8u_

PDB Entry: 1kc8 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Blasticidin S Bound to the 50S Ribosomal Subunit
PDB Compounds: (U:) ribosomal protein l24

SCOPe Domain Sequences for d1kc8u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kc8u_ b.34.5.1 (U:) Ribosomal proteins L24 (L24p) {Haloarcula marismortui [TaxId: 2238]}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa

SCOPe Domain Coordinates for d1kc8u_:

Click to download the PDB-style file with coordinates for d1kc8u_.
(The format of our PDB-style files is described here.)

Timeline for d1kc8u_: