Lineage for d1kc8t_ (1kc8 T:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 716450Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 716451Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 716452Family d.12.1.1: L23p [54190] (1 protein)
  6. 716453Protein Ribosomal protein L23 [54191] (2 species)
  7. 716454Species Archaeon Haloarcula marismortui [TaxId:2238] [54192] (44 PDB entries)
  8. 716478Domain d1kc8t_: 1kc8 T: [84375]
    Other proteins in same PDB: d1kc81_, d1kc82_, d1kc83_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8h_, d1kc8i_, d1kc8j_, d1kc8k_, d1kc8l_, d1kc8m_, d1kc8n_, d1kc8o_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_, d1kc8z_
    complexed with bls, cd, cl, k, mg, na

Details for d1kc8t_

PDB Entry: 1kc8 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Blasticidin S Bound to the 50S Ribosomal Subunit
PDB Compounds: (T:) ribosomal protein l23

SCOP Domain Sequences for d1kc8t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kc8t_ d.12.1.1 (T:) Ribosomal protein L23 {Archaeon Haloarcula marismortui [TaxId: 2238]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

SCOP Domain Coordinates for d1kc8t_:

Click to download the PDB-style file with coordinates for d1kc8t_.
(The format of our PDB-style files is described here.)

Timeline for d1kc8t_: