Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.4: Translational machinery components [53137] (2 families) |
Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
Protein Ribosomal protein L18 (L18p) [53139] (5 species) |
Species Haloarcula marismortui [TaxId:2238] [53140] (40 PDB entries) Uniprot P14123 |
Domain d1kc8o_: 1kc8 O: [84370] Other proteins in same PDB: d1kc81_, d1kc82_, d1kc83_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8h_, d1kc8i_, d1kc8j_, d1kc8k_, d1kc8l_, d1kc8m_, d1kc8n_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_, d1kc8z_ complexed with bls, cd, cl, k, mg, na |
PDB Entry: 1kc8 (more details), 3.01 Å
SCOPe Domain Sequences for d1kc8o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kc8o_ c.55.4.1 (O:) Ribosomal protein L18 (L18p) {Haloarcula marismortui [TaxId: 2238]} atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll dgdiel
Timeline for d1kc8o_:
View in 3D Domains from other chains: (mouse over for more information) d1kc81_, d1kc82_, d1kc83_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8h_, d1kc8i_, d1kc8j_, d1kc8k_, d1kc8l_, d1kc8m_, d1kc8n_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_, d1kc8z_ |