![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily) beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243 |
![]() | Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) ![]() |
![]() | Family d.12.1.2: L15e [54193] (1 protein) elaborated with additional structures automatically mapped to Pfam PF00827 |
![]() | Protein Ribosomal protein L15e [54194] (1 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [54195] (42 PDB entries) Uniprot P60618 |
![]() | Domain d1kc8n_: 1kc8 N: [84369] Other proteins in same PDB: d1kc81_, d1kc82_, d1kc83_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8h_, d1kc8i_, d1kc8j_, d1kc8k_, d1kc8l_, d1kc8m_, d1kc8o_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_, d1kc8z_ complexed with bls, cd, cl, k, mg, na |
PDB Entry: 1kc8 (more details), 3.01 Å
SCOPe Domain Sequences for d1kc8n_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kc8n_ d.12.1.2 (N:) Ribosomal protein L15e {Haloarcula marismortui [TaxId: 2238]} arsaysyireawkrpkegqiaelmwhrmqewrnepavvrierptrldrarslgykakqgi ivvrvairkgssrrtrfnkgrrskrmmvnritrkkniqriaeeranrkfpnlrvlnsysv gedgrhkwhevilidpdhpaiksddqlswisrtrhrlrtfrgltsagrrcrglrgqgkgs ekvrpslrvngaka
Timeline for d1kc8n_:
![]() Domains from other chains: (mouse over for more information) d1kc81_, d1kc82_, d1kc83_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8h_, d1kc8i_, d1kc8j_, d1kc8k_, d1kc8l_, d1kc8m_, d1kc8o_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_, d1kc8z_ |