Lineage for d1kc8l_ (1kc8 L:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373873Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 373874Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
  5. 373875Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 373876Protein Ribosomal protein L14 [50195] (2 species)
  7. 373877Species Archaeon Haloarcula marismortui [TaxId:2238] [50197] (18 PDB entries)
  8. 373882Domain d1kc8l_: 1kc8 L: [84367]
    Other proteins in same PDB: d1kc81_, d1kc82_, d1kc83_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8h_, d1kc8i_, d1kc8j_, d1kc8k_, d1kc8m_, d1kc8n_, d1kc8o_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_, d1kc8z_
    complexed with bls, cd, cl, k, mg, na

Details for d1kc8l_

PDB Entry: 1kc8 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Blasticidin S Bound to the 50S Ribosomal Subunit

SCOP Domain Sequences for d1kc8l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kc8l_ b.39.1.1 (L:) Ribosomal protein L14 {Archaeon Haloarcula marismortui}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrhpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

SCOP Domain Coordinates for d1kc8l_:

Click to download the PDB-style file with coordinates for d1kc8l_.
(The format of our PDB-style files is described here.)

Timeline for d1kc8l_: