SCOPe 2.06: Domain d1kc8k_: 1kc8 K:

Lineage for d1kc8k_ (1kc8 K:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family)

5. Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)

6. Protein Ribosomal protein L13 [52163] (5 species)
   synonym: 50S ribosomal protein L13p, HMAL13

7. Species Haloarcula marismortui [TaxId:2238] [52164] (40 PDB entries)
   Uniprot P29198

8. Domain d1kc8k_: 1kc8 K: [84366]
   Other proteins in same PDB: d1kc81_, d1kc82_, d1kc83_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8h_, d1kc8i_, d1kc8j_, d1kc8l_, d1kc8m_, d1kc8n_, d1kc8o_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_, d1kc8z_
   complexed with bls, cd, cl, k, mg, na

Details for d1kc8k_

PDB Entry: 1kc8, 3.01 Å

PDB Description: Co-crystal Structure of Blasticidin S Bound to the 50S Ribosomal Subunit

PDB Compounds: (K:) ribosomal protein l13

SCOPe Domain Sequences for d1kc8k_:

Sequence; same for both SEQRES and ATOM records:

>d1kc8k_ c.21.1.1 (K:) Ribosomal protein L13 {Haloarcula marismortui [TaxId: 2238]}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
lsnikfvtlgeisetlganktw

Timeline for d1kc8k_:

• d1kc8k_ first appeared in SCOP 1.65
  
• d1kc8k_ appears in SCOPe 2.05
  
• d1kc8k_ appears in SCOPe 2.07
  
• d1kc8k_ appears in the current release, SCOPe 2.08