Lineage for d1kc8k_ (1kc8 K:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 481017Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214
  4. 481018Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) (S)
  5. 481019Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)
  6. 481020Protein Ribosomal protein L13 [52163] (2 species)
    synonym: 50S ribosomal protein L13p, HMAL13
  7. 481021Species Archaeon Haloarcula marismortui [TaxId:2238] [52164] (19 PDB entries)
  8. 481027Domain d1kc8k_: 1kc8 K: [84366]
    Other proteins in same PDB: d1kc81_, d1kc82_, d1kc83_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8h_, d1kc8i_, d1kc8j_, d1kc8l_, d1kc8m_, d1kc8n_, d1kc8o_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_, d1kc8z_

Details for d1kc8k_

PDB Entry: 1kc8 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Blasticidin S Bound to the 50S Ribosomal Subunit

SCOP Domain Sequences for d1kc8k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kc8k_ c.21.1.1 (K:) Ribosomal protein L13 {Archaeon Haloarcula marismortui}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
lsnikfvtlgeisetlganktw

SCOP Domain Coordinates for d1kc8k_:

Click to download the PDB-style file with coordinates for d1kc8k_.
(The format of our PDB-style files is described here.)

Timeline for d1kc8k_: