Lineage for d1kc8i_ (1kc8 I:)

  1. Root: SCOPe 2.01
  2. 1072259Class j: Peptides [58231] (120 folds)
  3. 1073736Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)
  4. 1073737Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) (S)
  5. 1073738Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)
  6. 1073739Protein Ribosomal protein L10 [64661] (1 species)
    two alpha-helical segments visible in the crystal structure
  7. 1073740Species Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries)
    Uniprot P15825
  8. 1073769Domain d1kc8i_: 1kc8 I: [84364]
    Other proteins in same PDB: d1kc81_, d1kc82_, d1kc83_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8h_, d1kc8j_, d1kc8k_, d1kc8l_, d1kc8m_, d1kc8n_, d1kc8o_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_, d1kc8z_
    complexed with bls, cd, cl, k, mg, na

Details for d1kc8i_

PDB Entry: 1kc8 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Blasticidin S Bound to the 50S Ribosomal Subunit
PDB Compounds: (I:) ribosomal protein l10

SCOPe Domain Sequences for d1kc8i_:

Sequence, based on SEQRES records: (download)

>d1kc8i_ j.84.1.1 (I:) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records): (download)

>d1kc8i_ j.84.1.1 (I:) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd

SCOPe Domain Coordinates for d1kc8i_:

Click to download the PDB-style file with coordinates for d1kc8i_.
(The format of our PDB-style files is described here.)

Timeline for d1kc8i_: