![]() | Class j: Peptides [58231] (120 folds) |
![]() | Fold j.84: Ribosomal protein L10 [64658] (1 superfamily) |
![]() | Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) ![]() |
![]() | Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein) |
![]() | Protein Ribosomal protein L10 [64661] (1 species) two alpha-helical segments visible in the crystal structure |
![]() | Species Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries) Uniprot P15825 |
![]() | Domain d1kc8i_: 1kc8 I: [84364] Other proteins in same PDB: d1kc81_, d1kc82_, d1kc83_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8h_, d1kc8j_, d1kc8k_, d1kc8l_, d1kc8m_, d1kc8n_, d1kc8o_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_, d1kc8z_ complexed with bls, cd, cl, k, mg, na |
PDB Entry: 1kc8 (more details), 3.01 Å
SCOPe Domain Sequences for d1kc8i_:
Sequence, based on SEQRES records: (download)
>d1kc8i_ j.84.1.1 (I:) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]} ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral dd
>d1kc8i_ j.84.1.1 (I:) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]} ipewkqeevdaivemiesrntlleraldd
Timeline for d1kc8i_:
![]() Domains from other chains: (mouse over for more information) d1kc81_, d1kc82_, d1kc83_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8h_, d1kc8j_, d1kc8k_, d1kc8l_, d1kc8m_, d1kc8n_, d1kc8o_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_, d1kc8z_ |