Lineage for d1kc8h_ (1kc8 H:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201108Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2201846Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 2201847Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 2201864Protein Ribosomal protein L7ae [55319] (7 species)
  7. 2201872Species Haloarcula marismortui [TaxId:2238] [55320] (58 PDB entries)
    Uniprot P12743
  8. 2201903Domain d1kc8h_: 1kc8 H: [84363]
    Other proteins in same PDB: d1kc81_, d1kc82_, d1kc83_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8i_, d1kc8j_, d1kc8k_, d1kc8l_, d1kc8m_, d1kc8n_, d1kc8o_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_, d1kc8z_
    complexed with bls, cd, cl, k, mg, na

Details for d1kc8h_

PDB Entry: 1kc8 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Blasticidin S Bound to the 50S Ribosomal Subunit
PDB Compounds: (H:) ribosomal protein l7ae

SCOPe Domain Sequences for d1kc8h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kc8h_ d.79.3.1 (H:) Ribosomal protein L7ae {Haloarcula marismortui [TaxId: 2238]}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdagaaatvleeiadkveelr

SCOPe Domain Coordinates for d1kc8h_:

Click to download the PDB-style file with coordinates for d1kc8h_.
(The format of our PDB-style files is described here.)

Timeline for d1kc8h_: