SCOP 1.65: Domain d1kc8g2: 1kc8 G:80-172

Lineage for d1kc8g2 (1kc8 G:80-172)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (2 species)
   duplication: consists of two domains of this fold

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [56057] (12 PDB entries)

8. Domain d1kc8g2: 1kc8 G:80-172 [84362]
   Other proteins in same PDB: d1kc81_, d1kc82_, d1kc83_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8h_, d1kc8i_, d1kc8j_, d1kc8k_, d1kc8l_, d1kc8m_, d1kc8n_, d1kc8o_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_, d1kc8z_
   complexed with bls, cd, cl, k, mg, na

Details for d1kc8g2

PDB Entry: 1kc8, 3.01 Å

PDB Description: Co-crystal Structure of Blasticidin S Bound to the 50S Ribosomal Subunit

SCOP Domain Sequences for d1kc8g2:

Sequence; same for both SEQRES and ATOM records:

>d1kc8g2 d.141.1.1 (G:80-172) Ribosomal protein L6 {Archaeon Haloarcula marismortui}
weygmevfyshfpmqvnvegdevvienflgekaprrttihgdtdveidgeeltvsgpdie
avgqtaadieqltrindkdvrvfqdgvyitrkp

Timeline for d1kc8g2:

• d1kc8g2 is new in SCOP 1.65
  
• d1kc8g2 appears in SCOP 1.67
  
• d1kc8g2 appears in the current release, SCOPe 2.08