| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.141: Ribosomal protein L6 [56052] (1 superfamily) consists of two beta-sheets and one alpha-helix packed around single core |
Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) ![]() |
| Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein) |
| Protein Ribosomal protein L6 [56055] (2 species) duplication: consists of two domains of this fold |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries) |
| Domain d1kc8g1: 1kc8 G:1-79 [84361] Other proteins in same PDB: d1kc81_, d1kc82_, d1kc83_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8h_, d1kc8i_, d1kc8j_, d1kc8k_, d1kc8l_, d1kc8m_, d1kc8n_, d1kc8o_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_, d1kc8z_ |
PDB Entry: 1kc8 (more details), 3.01 Å
SCOP Domain Sequences for d1kc8g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kc8g1 d.141.1.1 (G:1-79) Ribosomal protein L6 {Archaeon Haloarcula marismortui [TaxId: 2238]}
prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
tigtfqshienmfhgvteg
Timeline for d1kc8g1:
View in 3DDomains from other chains: (mouse over for more information) d1kc81_, d1kc82_, d1kc83_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8h_, d1kc8i_, d1kc8j_, d1kc8k_, d1kc8l_, d1kc8m_, d1kc8n_, d1kc8o_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_, d1kc8z_ |