Lineage for d1kc8c1 (1kc8 C:91-237)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 295568Fold b.34: SH3-like barrel [50036] (13 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 295918Superfamily b.34.5: Translation proteins SH3-like domain [50104] (4 families) (S)
    many known members contain KOW motif
  5. 295962Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)
  6. 295963Protein C-terminal domain of ribosomal protein L2 [50115] (2 species)
  7. 295964Species Archaeon Haloarcula marismortui [TaxId:2238] [50117] (12 PDB entries)
  8. 295970Domain d1kc8c1: 1kc8 C:91-237 [84356]
    Other proteins in same PDB: d1kc81_, d1kc82_, d1kc83_, d1kc84_, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8h_, d1kc8i_, d1kc8j_, d1kc8k_, d1kc8l_, d1kc8m_, d1kc8n_, d1kc8o_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_, d1kc8z_
    complexed with bls, cd, cl, k, mg, na

Details for d1kc8c1

PDB Entry: 1kc8 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Blasticidin S Bound to the 50S Ribosomal Subunit

SCOP Domain Sequences for d1kc8c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kc8c1 b.34.5.3 (C:91-237) C-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui}
gntlplaeipegvpvcnvesspgdggkfarasgvnaqllthdrnvavvklpsgemkrldp
qcratigvvggggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfggggrqhpg
kpksisrnappgrkvgdiaskrtgrgg

SCOP Domain Coordinates for d1kc8c1:

Click to download the PDB-style file with coordinates for d1kc8c1.
(The format of our PDB-style files is described here.)

Timeline for d1kc8c1: