SCOP 1.73: Domain d1kc83_: 1kc8 3:

Lineage for d1kc83_ (1kc8 3:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (12 superfamilies)
   not a true fold

4. Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family)
   interrupted alpha-helix

5. Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)

6. Protein Ribosomal protein L39e [48664] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [48665] (19 PDB entries)

8. Domain d1kc83_: 1kc8 3: [84354]
   Other proteins in same PDB: d1kc81_, d1kc82_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8h_, d1kc8i_, d1kc8j_, d1kc8k_, d1kc8l_, d1kc8m_, d1kc8n_, d1kc8o_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_, d1kc8z_
   complexed with bls, cd, cl, k, mg, na

Details for d1kc83_

PDB Entry: 1kc8, 3.01 Å

PDB Description: Co-crystal Structure of Blasticidin S Bound to the 50S Ribosomal Subunit

PDB Compounds: (3:) ribosomal protein l39e

SCOP Domain Sequences for d1kc83_:

Sequence, based on SEQRES records:

>d1kc83_ a.137.1.1 (3:) Ribosomal protein L39e {Archaeon Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records):

>d1kc83_ a.137.1.1 (3:) Ribosomal protein L39e {Archaeon Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdernhkrrhwrrndtde

Timeline for d1kc83_:

• d1kc83_ first appeared in SCOP 1.65
  
• d1kc83_ appears in SCOP 1.71
  
• d1kc83_ appears in SCOP 1.75
  
• d1kc83_ appears in the current release, SCOPe 2.08