Lineage for d1k73z_ (1k73 Z:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 690198Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 690234Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) (S)
  5. 690235Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
    contains irregular N-terminal extension to the common fold
  6. 690236Protein Ribosomal protein L32e [52044] (1 species)
  7. 690237Species Archaeon Haloarcula marismortui [TaxId:2238] [52045] (40 PDB entries)
  8. 690264Domain d1k73z_: 1k73 Z: [84342]
    Other proteins in same PDB: d1k731_, d1k732_, d1k733_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73e_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73i_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73o_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73y_
    complexed with anm, cd, cl, k, mg, na

Details for d1k73z_

PDB Entry: 1k73 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Anisomycin Bound to the 50S Ribosomal Subunit
PDB Compounds: (Z:) ribosomal protein l32e

SCOP Domain Sequences for d1k73z_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k73z_ c.9.2.1 (Z:) Ribosomal protein L32e {Archaeon Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

SCOP Domain Coordinates for d1k73z_:

Click to download the PDB-style file with coordinates for d1k73z_.
(The format of our PDB-style files is described here.)

Timeline for d1k73z_: