Lineage for d1k73x_ (1k73 X:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1912088Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
    core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold
  4. 1912089Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) (S)
  5. 1912090Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)
  6. 1912091Protein Archaeal L30 (L30a) [55133] (1 species)
    long-chain member of the family; contains additional C-terminal (sub)domain
  7. 1912092Species Haloarcula marismortui [TaxId:2238] [55134] (40 PDB entries)
    Uniprot P14121
  8. 1912125Domain d1k73x_: 1k73 X: [84340]
    Other proteins in same PDB: d1k731_, d1k732_, d1k733_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73e_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73i_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73o_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73y_, d1k73z_
    complexed with anm, cd, cl, k, mg, na

Details for d1k73x_

PDB Entry: 1k73 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Anisomycin Bound to the 50S Ribosomal Subunit
PDB Compounds: (X:) ribosomal protein l30

SCOPe Domain Sequences for d1k73x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k73x_ d.59.1.1 (X:) Archaeal L30 (L30a) {Haloarcula marismortui [TaxId: 2238]}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr

SCOPe Domain Coordinates for d1k73x_:

Click to download the PDB-style file with coordinates for d1k73x_.
(The format of our PDB-style files is described here.)

Timeline for d1k73x_: