Lineage for d1k73q_ (1k73 Q:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 283987Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 283988Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
  5. 283989Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 283990Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 283991Species Archaeon Haloarcula marismortui [TaxId:2238] [48143] (12 PDB entries)
  8. 283999Domain d1k73q_: 1k73 Q: [84333]
    Other proteins in same PDB: d1k731_, d1k732_, d1k733_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73e_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73i_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73o_, d1k73p_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73y_, d1k73z_
    complexed with anm, cd, cl, k, mg, na

Details for d1k73q_

PDB Entry: 1k73 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Anisomycin Bound to the 50S Ribosomal Subunit

SCOP Domain Sequences for d1k73q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k73q_ a.94.1.1 (Q:) Ribosomal protein L19 (L19e) {Archaeon Haloarcula marismortui}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOP Domain Coordinates for d1k73q_:

Click to download the PDB-style file with coordinates for d1k73q_.
(The format of our PDB-style files is described here.)

Timeline for d1k73q_: