SCOP 1.65: Domain d1k73p_: 1k73 P:

Lineage for d1k73p_ (1k73 P:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
   core: three turns of irregular (beta-beta-alpha)n superhelix

4. Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family)

5. Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)

6. Protein Ribosomal protein L18e [52084] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [52085] (12 PDB entries)

8. Domain d1k73p_: 1k73 P: [84332]
   Other proteins in same PDB: d1k731_, d1k732_, d1k733_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73e_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73i_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73o_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73y_, d1k73z_
   complexed with anm, cd, cl, k, mg, na

Details for d1k73p_

PDB Entry: 1k73, 3.01 Å

PDB Description: Co-crystal Structure of Anisomycin Bound to the 50S Ribosomal Subunit

SCOP Domain Sequences for d1k73p_:

Sequence; same for both SEQRES and ATOM records:

>d1k73p_ c.12.1.1 (P:) Ribosomal protein L18e {Archaeon Haloarcula marismortui}
sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir

Timeline for d1k73p_:

• d1k73p_ is new in SCOP 1.65
  
• d1k73p_ appears in SCOP 1.67
  
• d1k73p_ appears in the current release, SCOPe 2.08