Lineage for d1k73n_ (1k73 N:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325126Fold d.12: Ribosomal proteins L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 325127Superfamily d.12.1: Ribosomal proteins L23 and L15e [54189] (2 families) (S)
  5. 325145Family d.12.1.2: L15e [54193] (1 protein)
    elaborated with additional structures
  6. 325146Protein Ribosomal protein L15e [54194] (1 species)
  7. 325147Species Archaeon Haloarcula marismortui [TaxId:2238] [54195] (12 PDB entries)
  8. 325155Domain d1k73n_: 1k73 N: [84330]
    Other proteins in same PDB: d1k731_, d1k732_, d1k733_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73e_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73i_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73o_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73y_, d1k73z_
    complexed with anm, cd, cl, k, mg, na

Details for d1k73n_

PDB Entry: 1k73 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Anisomycin Bound to the 50S Ribosomal Subunit

SCOP Domain Sequences for d1k73n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k73n_ d.12.1.2 (N:) Ribosomal protein L15e {Archaeon Haloarcula marismortui}
arsaysyireawkrpkegqiaelmwhrmqewrnepavvrierptrldrarslgykakqgi
ivvrvairkgssrrtrfnkgrrskrmmvnritrkkniqriaeeranrkfpnlrvlnsysv
gedgrhkwhevilidpdhpaiksddqlswisrtrhrlrtfrgltsagrrcrglrgqgkgs
ekvrpslrvngaka

SCOP Domain Coordinates for d1k73n_:

Click to download the PDB-style file with coordinates for d1k73n_.
(The format of our PDB-style files is described here.)

Timeline for d1k73n_: