Lineage for d1k73k_ (1k73 K:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 981990Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214
  4. 981991Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) (S)
  5. 981992Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)
  6. 981993Protein Ribosomal protein L13 [52163] (5 species)
    synonym: 50S ribosomal protein L13p, HMAL13
  7. 982031Species Haloarcula marismortui [TaxId:2238] [52164] (44 PDB entries)
    Uniprot P29198
  8. 982064Domain d1k73k_: 1k73 K: [84327]
    Other proteins in same PDB: d1k731_, d1k732_, d1k733_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73e_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73i_, d1k73j_, d1k73l_, d1k73m_, d1k73n_, d1k73o_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73y_, d1k73z_
    complexed with anm, cd, cl, k, mg, na

Details for d1k73k_

PDB Entry: 1k73 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Anisomycin Bound to the 50S Ribosomal Subunit
PDB Compounds: (K:) ribosomal protein l13

SCOPe Domain Sequences for d1k73k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k73k_ c.21.1.1 (K:) Ribosomal protein L13 {Haloarcula marismortui [TaxId: 2238]}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
lsnikfvtlgeisetlganktw

SCOPe Domain Coordinates for d1k73k_:

Click to download the PDB-style file with coordinates for d1k73k_.
(The format of our PDB-style files is described here.)

Timeline for d1k73k_: