Lineage for d1k73i_ (1k73 I:)

  1. Root: SCOPe 2.02
  2. 1251156Class j: Peptides [58231] (120 folds)
  3. 1252630Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)
  4. 1252631Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) (S)
  5. 1252632Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)
  6. 1252633Protein Ribosomal protein L10 [64661] (1 species)
    two alpha-helical segments visible in the crystal structure
  7. 1252634Species Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries)
    Uniprot P15825
  8. 1252669Domain d1k73i_: 1k73 I: [84325]
    Other proteins in same PDB: d1k731_, d1k732_, d1k733_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73e_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73o_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73y_, d1k73z_
    complexed with anm, cd, cl, k, mg, na

Details for d1k73i_

PDB Entry: 1k73 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Anisomycin Bound to the 50S Ribosomal Subunit
PDB Compounds: (I:) ribosomal protein l10

SCOPe Domain Sequences for d1k73i_:

Sequence, based on SEQRES records: (download)

>d1k73i_ j.84.1.1 (I:) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records): (download)

>d1k73i_ j.84.1.1 (I:) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd

SCOPe Domain Coordinates for d1k73i_:

Click to download the PDB-style file with coordinates for d1k73i_.
(The format of our PDB-style files is described here.)

Timeline for d1k73i_: