Class j: Peptides [58231] (120 folds) |
Fold j.84: Ribosomal protein L10 [64658] (1 superfamily) |
Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) |
Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein) |
Protein Ribosomal protein L10 [64661] (1 species) two alpha-helical segments visible in the crystal structure |
Species Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries) Uniprot P15825 |
Domain d1k73i_: 1k73 I: [84325] Other proteins in same PDB: d1k731_, d1k732_, d1k733_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73e_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73o_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73y_, d1k73z_ complexed with anm, cd, cl, k, mg, na |
PDB Entry: 1k73 (more details), 3.01 Å
SCOPe Domain Sequences for d1k73i_:
Sequence, based on SEQRES records: (download)
>d1k73i_ j.84.1.1 (I:) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]} ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral dd
>d1k73i_ j.84.1.1 (I:) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]} ipewkqeevdaivemiesrntlleraldd
Timeline for d1k73i_:
View in 3D Domains from other chains: (mouse over for more information) d1k731_, d1k732_, d1k733_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73e_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73o_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73y_, d1k73z_ |