Lineage for d1k73g2 (1k73 G:80-172)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1670915Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 1670916Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
    automatically mapped to Pfam PF00347
  5. 1670917Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 1670918Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 1670990Species Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries)
    Uniprot P14135
  8. 1671056Domain d1k73g2: 1k73 G:80-172 [84323]
    Other proteins in same PDB: d1k731_, d1k732_, d1k733_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73e_, d1k73f_, d1k73h_, d1k73i_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73o_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73y_, d1k73z_
    complexed with anm, cd, cl, k, mg, na

Details for d1k73g2

PDB Entry: 1k73 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Anisomycin Bound to the 50S Ribosomal Subunit
PDB Compounds: (G:) ribosomal protein l6

SCOPe Domain Sequences for d1k73g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k73g2 d.141.1.1 (G:80-172) Ribosomal protein L6 {Haloarcula marismortui [TaxId: 2238]}
weygmevfyshfpmqvnvegdevvienflgekaprrttihgdtdveidgeeltvsgpdie
avgqtaadieqltrindkdvrvfqdgvyitrkp

SCOPe Domain Coordinates for d1k73g2:

Click to download the PDB-style file with coordinates for d1k73g2.
(The format of our PDB-style files is described here.)

Timeline for d1k73g2: