Lineage for d1k73e_ (1k73 E:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463596Fold c.22: Ribosomal protein L4 [52165] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423
  4. 2463597Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) (S)
    automatically mapped to Pfam PF00573
  5. 2463598Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein)
  6. 2463599Protein Ribosomal protein L4 [52168] (5 species)
    synonym: 50S ribosomal protein L4e, HMAL4, HL6
  7. 2463637Species Haloarcula marismortui [TaxId:2238] [52170] (42 PDB entries)
    Uniprot P12735
  8. 2463664Domain d1k73e_: 1k73 E: [84320]
    Other proteins in same PDB: d1k731_, d1k732_, d1k733_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73i_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73o_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73y_, d1k73z_
    complexed with anm, cd, cl, k, mg, na

Details for d1k73e_

PDB Entry: 1k73 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Anisomycin Bound to the 50S Ribosomal Subunit
PDB Compounds: (E:) ribosomal protein l4

SCOPe Domain Sequences for d1k73e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k73e_ c.22.1.1 (E:) Ribosomal protein L4 {Haloarcula marismortui [TaxId: 2238]}
mqatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes
fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad
adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs
argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal
aevaer

SCOPe Domain Coordinates for d1k73e_:

Click to download the PDB-style file with coordinates for d1k73e_.
(The format of our PDB-style files is described here.)

Timeline for d1k73e_: