| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.22: Ribosomal protein L4 [52165] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) ![]() |
| Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein) |
| Protein Ribosomal protein L4 [52168] (5 species) synonym: 50S ribosomal protein L4e, HMAL4, HL6 |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [52170] (46 PDB entries) Uniprot P12735 |
| Domain d1k73e_: 1k73 E: [84320] Other proteins in same PDB: d1k731_, d1k732_, d1k733_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73i_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73o_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73y_, d1k73z_ complexed with anm, cd, cl, k, mg, na |
PDB Entry: 1k73 (more details), 3.01 Å
SCOP Domain Sequences for d1k73e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k73e_ c.22.1.1 (E:) Ribosomal protein L4 {Archaeon Haloarcula marismortui [TaxId: 2238]}
mqatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes
fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad
adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs
argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal
aevaer
Timeline for d1k73e_:
View in 3DDomains from other chains: (mouse over for more information) d1k731_, d1k732_, d1k733_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73i_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73o_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73y_, d1k73z_ |