SCOP 1.65: Domain d1k73c2: 1k73 C:1-90

Lineage for d1k73c2 (1k73 C:1-90)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.40: OB-fold [50198] (9 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (11 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (16 proteins)
   barrel, closed; n=5, S=8

6. Protein N-terminal domain of ribosomal protein L2 [50299] (2 species)
   lacks the last strand

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [50301] (12 PDB entries)
   includes the N-terminal tail

8. Domain d1k73c2: 1k73 C:1-90 [84318]
   Other proteins in same PDB: d1k731_, d1k732_, d1k733_, d1k734_, d1k73c1, d1k73d_, d1k73e_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73i_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73o_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73y_, d1k73z_
   complexed with anm, cd, cl, k, mg, na

Details for d1k73c2

PDB Entry: 1k73, 3.01 Å

PDB Description: Co-crystal Structure of Anisomycin Bound to the 50S Ribosomal Subunit

SCOP Domain Sequences for d1k73c2:

Sequence; same for both SEQRES and ATOM records:

>d1k73c2 b.40.4.5 (C:1-90) N-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui}
grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
edgdrrlilapegvgvgdelqvgvdaeiap

Timeline for d1k73c2:

• d1k73c2 is new in SCOP 1.65
  
• d1k73c2 appears in SCOP 1.67
  
• d1k73c2 appears in the current release, SCOPe 2.08