Lineage for d1k73c1 (1k73 C:91-237)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796588Superfamily b.34.5: Translation proteins SH3-like domain [50104] (7 families) (S)
    many known members contain KOW motif
  5. 796751Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)
  6. 796752Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)
  7. 796753Species Archaeon Haloarcula marismortui [TaxId:2238] [50117] (40 PDB entries)
    Uniprot P20276
  8. 796780Domain d1k73c1: 1k73 C:91-237 [84317]
    Other proteins in same PDB: d1k731_, d1k732_, d1k733_, d1k734_, d1k73c2, d1k73d_, d1k73e_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73i_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73o_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73y_, d1k73z_
    complexed with anm, cd, cl, k, mg, na

Details for d1k73c1

PDB Entry: 1k73 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Anisomycin Bound to the 50S Ribosomal Subunit
PDB Compounds: (C:) ribosomal protein l2

SCOP Domain Sequences for d1k73c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k73c1 b.34.5.3 (C:91-237) C-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui [TaxId: 2238]}
gntlplaeipegvpvcnvesspgdggkfarasgvnaqllthdrnvavvklpsgemkrldp
qcratigvvggggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfggggrqhpg
kpksisrnappgrkvgdiaskrtgrgg

SCOP Domain Coordinates for d1k73c1:

Click to download the PDB-style file with coordinates for d1k73c1.
(The format of our PDB-style files is described here.)

Timeline for d1k73c1: