Lineage for d1k734_ (1k73 4:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 751110Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (6 families) (S)
  5. 751197Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein)
  6. 751198Protein Ribosomal protein L44e [57837] (1 species)
  7. 751199Species Archaeon Haloarcula marismortui [TaxId:2238] [57838] (40 PDB entries)
  8. 751226Domain d1k734_: 1k73 4: [84316]
    Other proteins in same PDB: d1k731_, d1k732_, d1k733_, d1k73c1, d1k73c2, d1k73d_, d1k73e_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73i_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73o_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73y_, d1k73z_
    complexed with anm, cd, cl, k, mg, na

Details for d1k734_

PDB Entry: 1k73 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Anisomycin Bound to the 50S Ribosomal Subunit
PDB Compounds: (4:) ribosomal protein l44e

SCOP Domain Sequences for d1k734_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k734_ g.41.8.3 (4:) Ribosomal protein L44e {Archaeon Haloarcula marismortui [TaxId: 2238]}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

SCOP Domain Coordinates for d1k734_:

Click to download the PDB-style file with coordinates for d1k734_.
(The format of our PDB-style files is described here.)

Timeline for d1k734_: