SCOP 1.65: Domain d1k734_: 1k73 4:

Lineage for d1k734_ (1k73 4:)

1. Root: SCOP 1.65

2. Class g: Small proteins [56992] (66 folds)

3. Fold g.41: Rubredoxin-like [57769] (12 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (4 families)

5. Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein)

6. Protein Ribosomal protein L44e [57837] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [57838] (12 PDB entries)

8. Domain d1k734_: 1k73 4: [84316]
   Other proteins in same PDB: d1k731_, d1k732_, d1k733_, d1k73c1, d1k73c2, d1k73d_, d1k73e_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73i_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73o_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73y_, d1k73z_
   complexed with anm, cd, cl, k, mg, na

Details for d1k734_

PDB Entry: 1k73, 3.01 Å

PDB Description: Co-crystal Structure of Anisomycin Bound to the 50S Ribosomal Subunit

SCOP Domain Sequences for d1k734_:

Sequence; same for both SEQRES and ATOM records:

>d1k734_ g.41.8.3 (4:) Ribosomal protein L44e {Archaeon Haloarcula marismortui}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

Timeline for d1k734_:

• d1k734_ is new in SCOP 1.65
  
• d1k734_ appears in SCOP 1.67
  
• d1k734_ appears in the current release, SCOPe 2.08