Lineage for d1k733_ (1k73 3:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 649538Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (12 superfamilies)
    not a true fold
  4. 649539Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) (S)
    interrupted alpha-helix
  5. 649540Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)
  6. 649541Protein Ribosomal protein L39e [48664] (1 species)
  7. 649542Species Archaeon Haloarcula marismortui [TaxId:2238] [48665] (19 PDB entries)
  8. 649554Domain d1k733_: 1k73 3: [84315]
    Other proteins in same PDB: d1k731_, d1k732_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73e_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73i_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73o_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73y_, d1k73z_
    complexed with anm, cd, cl, k, mg, na

Details for d1k733_

PDB Entry: 1k73 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Anisomycin Bound to the 50S Ribosomal Subunit
PDB Compounds: (3:) ribosomal protein l39e

SCOP Domain Sequences for d1k733_:

Sequence, based on SEQRES records: (download)

>d1k733_ a.137.1.1 (3:) Ribosomal protein L39e {Archaeon Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records): (download)

>d1k733_ a.137.1.1 (3:) Ribosomal protein L39e {Archaeon Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdernhkrrhwrrndtde

SCOP Domain Coordinates for d1k733_:

Click to download the PDB-style file with coordinates for d1k733_.
(The format of our PDB-style files is described here.)

Timeline for d1k733_: