![]() | Class g: Small proteins [56992] (72 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (13 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (4 families) ![]() |
![]() | Family g.41.8.2: Ribosomal protein L37e [57833] (1 protein) |
![]() | Protein Ribosomal protein L37e [57834] (1 species) |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [57835] (18 PDB entries) |
![]() | Domain d1k732_: 1k73 2: [84314] Other proteins in same PDB: d1k731_, d1k733_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73e_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73i_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73o_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73y_, d1k73z_ complexed with anm, cd, cl, k, mg, na |
PDB Entry: 1k73 (more details), 3.01 Å
SCOP Domain Sequences for d1k732_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k732_ g.41.8.2 (2:) Ribosomal protein L37e {Archaeon Haloarcula marismortui} tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage
Timeline for d1k732_:
![]() Domains from other chains: (mouse over for more information) d1k731_, d1k733_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73e_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73i_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73o_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73y_, d1k73z_ |