Lineage for d1k731_ (1k73 1:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1965821Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1966433Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 1966434Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
    automatically mapped to Pfam PF01780
  6. 1966435Protein Ribosomal protein L37ae [57831] (1 species)
  7. 1966436Species Haloarcula marismortui [TaxId:2238] [57832] (58 PDB entries)
    Uniprot P60619
  8. 1966486Domain d1k731_: 1k73 1: [84313]
    Other proteins in same PDB: d1k732_, d1k733_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73e_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73i_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73o_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73y_, d1k73z_
    complexed with anm, cd, cl, k, mg, na

Details for d1k731_

PDB Entry: 1k73 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Anisomycin Bound to the 50S Ribosomal Subunit
PDB Compounds: (1:) ribosomal protein l37ae

SCOPe Domain Sequences for d1k731_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k731_ g.41.8.1 (1:) Ribosomal protein L37ae {Haloarcula marismortui [TaxId: 2238]}
rtgrfgpryglkirvrvadveikhkkkhkcpvcgfkklkragtgiwmcghcgykiaggcy
qpetvagkavmka

SCOPe Domain Coordinates for d1k731_:

Click to download the PDB-style file with coordinates for d1k731_.
(The format of our PDB-style files is described here.)

Timeline for d1k731_: