Lineage for d1k72b1 (1k72 B:2-456)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335133Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2335134Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2335152Family a.102.1.2: Cellulases catalytic domain [48213] (12 proteins)
  6. 2335188Protein Endo/exocellulase:cellobiose E-4, N-terminal domain [48216] (2 species)
  7. 2335189Species Clostridium cellulolyticum, atcc 35319 [TaxId:1521] [89107] (4 PDB entries)
    endoglucanase 9G
  8. 2335191Domain d1k72b1: 1k72 B:2-456 [84311]
    Other proteins in same PDB: d1k72a2, d1k72b2
    complexed with ca, cbi, glc, gol, mg

Details for d1k72b1

PDB Entry: 1k72 (more details), 1.8 Å

PDB Description: the x-ray crystal structure of cel9g complexed with cellotriose
PDB Compounds: (B:) endoglucanase 9g

SCOPe Domain Sequences for d1k72b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k72b1 a.102.1.2 (B:2-456) Endo/exocellulase:cellobiose E-4, N-terminal domain {Clostridium cellulolyticum, atcc 35319 [TaxId: 1521]}
gtynygealqksimfyefqrsgdlpadkrdnwrddsgmkdgsdvgvdltggwydagdhvk
fnlpmsytsamlawslyedkdaydksgqtkyimdgikwandyfikcnptpgvyyyqvgdg
gkdhswwgpaevmqmerpsfkvdaskpgsavcastaaslasaavvfkssdptyaekcish
aknlfdmadkaksdagytaasgyyssssfyddlswaavwlylatndstyldkaesyvpnw
gkeqqtdiiaykwgqcwddvhygaelllakltnkqlykdsiemnldfwttgvngtrvsyt
pkglawlfqwgslrhattqaflagvyaewegctpskvsvykdflksqidyalgstgrsfv
vgygvnppqhphhrtahgswtdqmtsptyhrhtiygalvggpdnadgytdeinnyvnnei
acdynagftgalakmykhsggdpipnfkaiekitn

SCOPe Domain Coordinates for d1k72b1:

Click to download the PDB-style file with coordinates for d1k72b1.
(The format of our PDB-style files is described here.)

Timeline for d1k72b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k72b2