Lineage for d1k2db2 (1k2d B:5-92)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938367Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2938474Species Mouse (Mus musculus), I-AU [TaxId:10090] [89860] (2 PDB entries)
  8. 2938475Domain d1k2db2: 1k2d B:5-92 [84294]
    Other proteins in same PDB: d1k2da1, d1k2da2, d1k2da3, d1k2db1
    complexed with nag
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1k2db2

PDB Entry: 1k2d (more details), 2.2 Å

PDB Description: crystal structure of the autoimmune mhc class ii i-au complexed with myelin basic protein 1-11 at 2.2a
PDB Compounds: (B:) H-2 class II histocompatibility antigen, A-U beta chain

SCOPe Domain Sequences for d1k2db2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k2db2 d.19.1.1 (B:5-92) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]}
rhfvvqfqpfcyftngtqriryvtryiynreeylrfdsdvgeyravtelgrpdaeyynkq
ylertraeldtvcrynyeetevptslr

SCOPe Domain Coordinates for d1k2db2:

Click to download the PDB-style file with coordinates for d1k2db2.
(The format of our PDB-style files is described here.)

Timeline for d1k2db2: