Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies) variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands |
Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) in the different families beta-barrels are similarly distorted but may vary in the number of strands |
Family c.6.2.2: 4-alpha-glucanotransferase, N-terminal domain [89554] (1 protein) family 57 glycoside hydrolase; overall domain organization is similar to that of the alpha-mannosidase family automatically mapped to Pfam PF03065 |
Protein 4-alpha-glucanotransferase, N-terminal domain [89555] (1 species) |
Species Thermococcus litoralis [TaxId:2265] [89556] (3 PDB entries) |
Domain d1k1yb3: 1k1y B:2-310 [84290] Other proteins in same PDB: d1k1ya1, d1k1ya2, d1k1yb1, d1k1yb2 complexed with acr, ca, mal, trs |
PDB Entry: 1k1y (more details), 2.4 Å
SCOPe Domain Sequences for d1k1yb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k1yb3 c.6.2.2 (B:2-310) 4-alpha-glucanotransferase, N-terminal domain {Thermococcus litoralis [TaxId: 2265]} erinfifgihnhqplgnfgwvfeeaynrsyrpfmeileefpemkvnvhfsgpllewieen kpdyldllrslikrgqleivvagfyepvlaaipkedrlvqiemlkdyarklgydakgvwl tervwqpelvkslreagieyvvvddyhfmsaglskeelfwpyytedggevitvfpidekl rylipfrpvkktieylesltsddpskvavfhddgekfgvwpgtyewvyekgwlreffdai tsnekinlmtyseylskftprglvylpiasyfemsewslpakqaklfvefveqlkeegkf ekyrvfvrg
Timeline for d1k1yb3: