Lineage for d1k1yb2 (1k1y B:385-659)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2044543Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2044682Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2045082Family b.30.5.8: 4-alpha-glucanotransferase, C-terminal domain [89286] (1 protein)
    family 57 glycoside hydrolase; overall domain organization is similar to that of the alpha-mannosidase family
    automatically mapped to Pfam PF09095
  6. 2045083Protein 4-alpha-glucanotransferase, C-terminal domain [89287] (1 species)
  7. 2045084Species Thermococcus litoralis [TaxId:2265] [89288] (3 PDB entries)
  8. 2045088Domain d1k1yb2: 1k1y B:385-659 [84289]
    Other proteins in same PDB: d1k1ya1, d1k1ya3, d1k1yb1, d1k1yb3
    complexed with acr, ca, mal, trs

Details for d1k1yb2

PDB Entry: 1k1y (more details), 2.4 Å

PDB Description: Crystal structure of thermococcus litoralis 4-alpha-glucanotransferase complexed with acarbose
PDB Compounds: (B:) 4-alpha-glucanotransferase

SCOPe Domain Sequences for d1k1yb2:

Sequence, based on SEQRES records: (download)

>d1k1yb2 b.30.5.8 (B:385-659) 4-alpha-glucanotransferase, C-terminal domain {Thermococcus litoralis [TaxId: 2265]}
kpenkildvdfdgraeimvendgfiatikphyggsifelsskrkavnyndvlprrwehyh
evpeatkpekeseegiasihelgkqipeeirrelaydwqlrailqdhfikpeetldnyrl
vkyhelgdfvnqpyeyemiengvklwreggvyaeekiparvekkieltedgfiakyrvll
ekpykalfgveinlavhsvmekpeefeakefevndpygigkvrieldkaakvwkfpiktl
sqseagwdfiqqgvsytmlfpiekeleftvrfrel

Sequence, based on observed residues (ATOM records): (download)

>d1k1yb2 b.30.5.8 (B:385-659) 4-alpha-glucanotransferase, C-terminal domain {Thermococcus litoralis [TaxId: 2265]}
kpenkildvdfdgraeimvendgfiatikphyggsifelsskrkavnyndvlprrwehyh
evqipeeirrelaydwqlrailqdhfikpeetldnyrlvkyhelgdfvnqpyeyemieng
vklwreggvyaeekiparvekkieltedgfiakyrvllekpykalfgveinlavhsvmek
peefeakefevndpygigkvrieldkaakvwkfpiktlsqseagwdfiqqgvsytmlfpi
ekeleftvrfrel

SCOPe Domain Coordinates for d1k1yb2:

Click to download the PDB-style file with coordinates for d1k1yb2.
(The format of our PDB-style files is described here.)

Timeline for d1k1yb2: