Class a: All alpha proteins [46456] (285 folds) |
Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (4 families) |
Family a.8.3.2: 4-alpha-glucanotransferase, domain 2 [89013] (1 protein) family 57 glycoside hydrolase; overall domain organization is similar to that of the alpha-mannosidase family automatically mapped to Pfam PF09094 |
Protein 4-alpha-glucanotransferase, domain 2 [89014] (1 species) |
Species Thermococcus litoralis [TaxId:2265] [89015] (3 PDB entries) |
Domain d1k1yb1: 1k1y B:311-384 [84288] Other proteins in same PDB: d1k1ya2, d1k1ya3, d1k1yb2, d1k1yb3 complexed with acr, ca, mal, trs |
PDB Entry: 1k1y (more details), 2.4 Å
SCOPe Domain Sequences for d1k1yb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k1yb1 a.8.3.2 (B:311-384) 4-alpha-glucanotransferase, domain 2 {Thermococcus litoralis [TaxId: 2265]} giwknfffkypesnfmhkrmlmvskavrdnpearkyilkaqcndaywhgvfggiylphlr rtvweniikaqryl
Timeline for d1k1yb1: