Lineage for d1k1yb1 (1k1y B:311-384)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1481774Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 1481858Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (4 families) (S)
  5. 1481922Family a.8.3.2: 4-alpha-glucanotransferase, domain 2 [89013] (1 protein)
    family 57 glycoside hydrolase; overall domain organization is similar to that of the alpha-mannosidase family
    automatically mapped to Pfam PF09094
  6. 1481923Protein 4-alpha-glucanotransferase, domain 2 [89014] (1 species)
  7. 1481924Species Thermococcus litoralis [TaxId:2265] [89015] (3 PDB entries)
  8. 1481928Domain d1k1yb1: 1k1y B:311-384 [84288]
    Other proteins in same PDB: d1k1ya2, d1k1ya3, d1k1yb2, d1k1yb3
    complexed with acr, ca, mal, trs

Details for d1k1yb1

PDB Entry: 1k1y (more details), 2.4 Å

PDB Description: crystal structure of thermococcus litoralis 4-alpha-glucanotransferase complexed with acarbose
PDB Compounds: (B:) 4-alpha-glucanotransferase

SCOPe Domain Sequences for d1k1yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k1yb1 a.8.3.2 (B:311-384) 4-alpha-glucanotransferase, domain 2 {Thermococcus litoralis [TaxId: 2265]}
giwknfffkypesnfmhkrmlmvskavrdnpearkyilkaqcndaywhgvfggiylphlr
rtvweniikaqryl

SCOPe Domain Coordinates for d1k1yb1:

Click to download the PDB-style file with coordinates for d1k1yb1.
(The format of our PDB-style files is described here.)

Timeline for d1k1yb1: