SCOPe 2.02: Domain d1k1yb1: 1k1y B:311-384

Lineage for d1k1yb1 (1k1y B:311-384)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (3 families)

5. Family a.8.3.2: 4-alpha-glucanotransferase, domain 2 [89013] (1 protein)
   family 57 glycoside hydrolase; overall domain organization is similar to that of the alpha-mannosidase family

6. Protein 4-alpha-glucanotransferase, domain 2 [89014] (1 species)

7. Species Thermococcus litoralis [TaxId:2265] [89015] (3 PDB entries)

8. Domain d1k1yb1: 1k1y B:311-384 [84288]
   Other proteins in same PDB: d1k1ya2, d1k1ya3, d1k1yb2, d1k1yb3
   complexed with acr, ca, mal, trs

Details for d1k1yb1

PDB Entry: 1k1y, 2.4 Å

PDB Description: crystal structure of thermococcus litoralis 4-alpha-glucanotransferase complexed with acarbose

PDB Compounds: (B:) 4-alpha-glucanotransferase

SCOPe Domain Sequences for d1k1yb1:

Sequence; same for both SEQRES and ATOM records:

>d1k1yb1 a.8.3.2 (B:311-384) 4-alpha-glucanotransferase, domain 2 {Thermococcus litoralis [TaxId: 2265]}
giwknfffkypesnfmhkrmlmvskavrdnpearkyilkaqcndaywhgvfggiylphlr
rtvweniikaqryl

Timeline for d1k1yb1:

• d1k1yb1 first appeared in SCOP 1.65
  
• d1k1yb1 appears in SCOPe 2.01
  
• d1k1yb1 appears in SCOPe 2.03
  
• d1k1yb1 appears in the current release, SCOPe 2.08