SCOP 1.71: Domain d1k1ya3: 1k1y A:1-310

Lineage for d1k1ya3 (1k1y A:1-310)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
   variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands

4. Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (5 families)
   in the different families beta-barrels are similarly distorted but may vary in the number of strands

5. Family c.6.2.2: 4-alpha-glucanotransferase, N-terminal domain [89554] (1 protein)
   family 57 glycoside hydrolase; overall domain organization is similar to that of the alpha-mannosidase family

6. Protein 4-alpha-glucanotransferase, N-terminal domain [89555] (1 species)

7. Species Archaeon Thermococcus litoralis [TaxId:2265] [89556] (3 PDB entries)

8. Domain d1k1ya3: 1k1y A:1-310 [84287]
   Other proteins in same PDB: d1k1ya1, d1k1ya2, d1k1yb1, d1k1yb2

Details for d1k1ya3

PDB Entry: 1k1y, 2.4 Å

PDB Description: crystal structure of thermococcus litoralis 4-alpha-glucanotransferase complexed with acarbose

SCOP Domain Sequences for d1k1ya3:

Sequence; same for both SEQRES and ATOM records:

>d1k1ya3 c.6.2.2 (A:1-310) 4-alpha-glucanotransferase, N-terminal domain {Archaeon Thermococcus litoralis}
merinfifgihnhqplgnfgwvfeeaynrsyrpfmeileefpemkvnvhfsgpllewiee
nkpdyldllrslikrgqleivvagfyepvlaaipkedrlvqiemlkdyarklgydakgvw
ltervwqpelvkslreagieyvvvddyhfmsaglskeelfwpyytedggevitvfpidek
lrylipfrpvkktieylesltsddpskvavfhddgekfgvwpgtyewvyekgwlreffda
itsnekinlmtyseylskftprglvylpiasyfemsewslpakqaklfvefveqlkeegk
fekyrvfvrg

Timeline for d1k1ya3:

• d1k1ya3 first appeared in SCOP 1.65
  
• d1k1ya3 appears in SCOP 1.69
  
• d1k1ya3 appears in SCOP 1.73
  
• d1k1ya3 appears in the current release, SCOPe 2.08