Lineage for d1k1ya1 (1k1y A:311-384)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 278744Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (3 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 278778Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (2 families) (S)
  5. 278788Family a.8.3.2: 4-alpha-glucanotransferase, domain 2 [89013] (1 protein)
    family 57 glycoside hydrolase; overall domain organisation is similar to that of the alpha-mannosidase family
  6. 278789Protein 4-alpha-glucanotransferase, domain 2 [89014] (1 species)
  7. 278790Species Archaeon Thermococcus litoralis [TaxId:2265] [89015] (3 PDB entries)
  8. 278793Domain d1k1ya1: 1k1y A:311-384 [84285]
    Other proteins in same PDB: d1k1ya2, d1k1ya3, d1k1yb2, d1k1yb3

Details for d1k1ya1

PDB Entry: 1k1y (more details), 2.4 Å

PDB Description: crystal structure of thermococcus litoralis 4-alpha-glucanotransferase complexed with acarbose

SCOP Domain Sequences for d1k1ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k1ya1 a.8.3.2 (A:311-384) 4-alpha-glucanotransferase, domain 2 {Archaeon Thermococcus litoralis}
giwknfffkypesnfmhkrmlmvskavrdnpearkyilkaqcndaywhgvfggiylphlr
rtvweniikaqryl

SCOP Domain Coordinates for d1k1ya1:

Click to download the PDB-style file with coordinates for d1k1ya1.
(The format of our PDB-style files is described here.)

Timeline for d1k1ya1: