SCOP 1.75: Domain d1k1xb3: 1k1x B:2-310

Lineage for d1k1xb3 (1k1x B:2-310)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
   variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands

4. Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (8 families)
   in the different families beta-barrels are similarly distorted but may vary in the number of strands

5. Family c.6.2.2: 4-alpha-glucanotransferase, N-terminal domain [89554] (1 protein)
   family 57 glycoside hydrolase; overall domain organization is similar to that of the alpha-mannosidase family

6. Protein 4-alpha-glucanotransferase, N-terminal domain [89555] (1 species)

7. Species Archaeon Thermococcus litoralis [TaxId:2265] [89556] (3 PDB entries)

8. Domain d1k1xb3: 1k1x B:2-310 [84284]
   Other proteins in same PDB: d1k1xa1, d1k1xa2, d1k1xb1, d1k1xb2
   complexed with ca, trs

Details for d1k1xb3

PDB Entry: 1k1x, 2.4 Å

PDB Description: Crystal structure of 4-alpha-glucanotransferase from thermococcus litoralis

PDB Compounds: (B:) 4-alpha-glucanotransferase

SCOP Domain Sequences for d1k1xb3:

Sequence; same for both SEQRES and ATOM records:

>d1k1xb3 c.6.2.2 (B:2-310) 4-alpha-glucanotransferase, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]}
erinfifgihnhqplgnfgwvfeeaynrsyrpfmeileefpemkvnvhfsgpllewieen
kpdyldllrslikrgqleivvagfyepvlaaipkedrlvqiemlkdyarklgydakgvwl
tervwqpelvkslreagieyvvvddyhfmsaglskeelfwpyytedggevitvfpidekl
rylipfrpvkktieylesltsddpskvavfhddgekfgvwpgtyewvyekgwlreffdai
tsnekinlmtyseylskftprglvylpiasyfemsewslpakqaklfvefveqlkeegkf
ekyrvfvrg

Timeline for d1k1xb3:

• d1k1xb3 first appeared in SCOP 1.65
  
• d1k1xb3 appears in SCOP 1.73
  
• d1k1xb3 appears in SCOPe 2.01
  
• d1k1xb3 appears in the current release, SCOPe 2.08