Lineage for d1k1xb2 (1k1x B:385-659)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 372004Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 372072Superfamily b.30.5: Galactose mutarotase-like [74650] (8 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 372327Family b.30.5.8: 4-alpha-glucanotransferase, C-terminal domain [89286] (1 protein)
    family 57 glycoside hydrolase; overall domain organization is similar to that of the alpha-mannosidase family
  6. 372328Protein 4-alpha-glucanotransferase, C-terminal domain [89287] (1 species)
  7. 372329Species Archaeon Thermococcus litoralis [TaxId:2265] [89288] (3 PDB entries)
  8. 372331Domain d1k1xb2: 1k1x B:385-659 [84283]
    Other proteins in same PDB: d1k1xa1, d1k1xa3, d1k1xb1, d1k1xb3
    complexed with ca, trs

Details for d1k1xb2

PDB Entry: 1k1x (more details), 2.4 Å

PDB Description: Crystal structure of 4-alpha-glucanotransferase from thermococcus litoralis

SCOP Domain Sequences for d1k1xb2:

Sequence, based on SEQRES records: (download)

>d1k1xb2 b.30.5.8 (B:385-659) 4-alpha-glucanotransferase, C-terminal domain {Archaeon Thermococcus litoralis}
kpenkildvdfdgraeimvendgfiatikphyggsifelsskrkavnyndvlprrwehyh
evpeatkpekeseegiasihelgkqipeeirrelaydwqlrailqdhfikpeetldnyrl
vkyhelgdfvnqpyeyemiengvklwreggvyaeekiparvekkieltedgfiakyrvll
ekpykalfgveinlavhsvmekpeefeakefevndpygigkvrieldkaakvwkfpiktl
sqseagwdfiqqgvsytmlfpiekeleftvrfrel

Sequence, based on observed residues (ATOM records): (download)

>d1k1xb2 b.30.5.8 (B:385-659) 4-alpha-glucanotransferase, C-terminal domain {Archaeon Thermococcus litoralis}
kpenkildvdfdgraeimvendgfiatikphyggsifelsskrkavnyndvlprrwehyh
evqipeeirrelaydwqlrailqdhfikpeetldnyrlvkyhelgdfvnqpyeyemieng
vklwreggvyaeekiparvekkieltedgfiakyrvllekpykalfgveinlavhsvmek
peefeakefevndpygigkvrieldkaakvwkfpiktlsqseagwdfiqqgvsytmlfpi
ekeleftvrfrel

SCOP Domain Coordinates for d1k1xb2:

Click to download the PDB-style file with coordinates for d1k1xb2.
(The format of our PDB-style files is described here.)

Timeline for d1k1xb2: